Sequence 1: | NP_650061.1 | Gene: | scpr-B / 41357 | FlyBaseID: | FBgn0037888 | Length: | 262 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005249406.1 | Gene: | CRISP2 / 7180 | HGNCID: | 12024 | Length: | 278 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 45/198 - (22%) |
---|---|---|---|
Similarity: | 76/198 - (38%) | Gaps: | 56/198 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAIKCLILLTSLLGISLAAD-----YCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLI 60
Fly 61 LNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC---ESLPDKCRSTERFAYAG 122
Fly 123 QNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTH 187
Fly 188 VGC 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scpr-B | NP_650061.1 | SCP_euk | 58..210 | CDD:240180 | 35/136 (26%) |
CRISP2 | XP_005249406.1 | SCP_CRISP | 35..172 | CDD:240183 | 35/142 (25%) |
Crisp | 224..278 | CDD:285731 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165151280 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.750 |