DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and Glipr1l1

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:258 Identity:59/258 - (22%)
Similarity:90/258 - (34%) Gaps:78/258 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIK---------CLILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPH 56
            ||:|         .|.|:.|.|..:...|...:||..|               ||.:        
Mouse     1 MALKKKLNFLWTLVLYLIASRLPKAFGKDLPRVPTITD---------------PKFI-------- 42

  Fly    57 HKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC-----RSTE 116
             ...||:.||||..|.       |.|..|.::.|.::|:.||....:.|:...:.|     ...|
Mouse    43 -DAFLNIHNELRRKVQ-------PPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLE 99

  Fly   117 RFAYAGQNNALFQYSG-AETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIA 180
            .:.:.|:|    .|.| .||:..|..|      ||:.|..      ..:|.....::....:|..
Mouse   100 DYDFIGEN----IYLGRIETQPEDVVI------NWYNESK------YFNFDFNTCSEMCGHYTQV 148

  Fly   181 VAEKNTHVGCAAVR------FSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEKAT----TGCKN 232
            |..|...:|||...      ||...:     .||:: ..|.:|...||.|:..:    ..|:|
Mouse   149 VWAKTVKIGCAVSNCPNLKGFSAGLF-----VCNYSPAGNFIGFRPYTRGDSCSMCGQKTCEN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 39/163 (24%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 40/177 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841386
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.