DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and Glipr1l2

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:199 Identity:46/199 - (23%)
Similarity:75/199 - (37%) Gaps:42/199 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC----ESLPDKCRSTER-FAY 120
            :.|.||||..|       .|..|.:..|:|...||..|....|.|    .:..||...:.. |..
Mouse    55 VGLHNELRGTV-------FPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTE 112

  Fly   121 AGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEE--LPNKAVTKFTIAVAE 183
            .|:|    .:.|...::|    :...|.:|..||.:      .|:..:  :.::..:.:...|.:
Mouse   113 IGEN----MWVGPVEDFT----VTTAIRSWHEERKS------YSYLNDTCVEDQNCSHYIQLVWD 163

  Fly   184 KNTHVGCAAVRFSR--DFYNHFVLTCNFATSNIVGQPVYT---------PGEKATTG-CKN--RY 234
            .:..||||....:|  .|.:..:..||:|....:.:..|.         ||::.|.. |.|  |.
Mouse   164 SSYKVGCAVTSCARAGGFTHAALFICNYAPGGTLTRRPYQAGQFCSRCGPGDQCTDYLCSNTVRD 228

  Fly   235 GAAY 238
            .|.|
Mouse   229 EATY 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 36/157 (23%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 37/159 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.