DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and Crisp1

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001034482.2 Gene:Crisp1 / 654517 RGDID:1590757 Length:254 Species:Rattus norvegicus


Alignment Length:253 Identity:51/253 - (20%)
Similarity:94/253 - (37%) Gaps:55/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKCLILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFN 65
            ||:|.::||  .|..:|..   .:|....:|:.. ::..:::.    :.|.:.||..: |::..|
  Rat     1 MAMKLILLL--FLAATLTV---FVPVVTLRHLKL-DRALYNQL----ITESQTEPQEE-IVDTHN 54

  Fly    66 ELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC-----ESLPDKCRSTERFAYAGQNN 125
            ..|.||:       |.|..|.||||....:..|.:..:.|     :||..:..:|    :.|:|.
  Rat    55 AFRRNVS-------PPARNMLKMSWSSAAAENARILARYCDKSDSDSLERRLPNT----FCGENM 108

  Fly   126 ALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGC 190
            .:..|..:.:..         ||.|:.|.....   ...:|....:.....:|..|...:..:||
  Rat   109 HMENYPSSWSNV---------IEIWYNESKYFK---YGEWPSTDDDIETYHYTQMVWASSYLIGC 161

  Fly   191 AAVRFSRDFYNHFVLTCNFA----TSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLC 244
            ......|.....::..|::.    :.:.:..| |..|..    |:       |.||.|
  Rat   162 DVASCRRQKAATYLYVCHYCHEGNSQDTLNMP-YKEGPP----CQ-------DCPNNC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 31/156 (20%)
Crisp1NP_001034482.2 SCP 46..182 CDD:294090 31/159 (19%)
Crisp 200..254 CDD:285731 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344733
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.