DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and Crisp3

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:207 Identity:43/207 - (20%)
Similarity:73/207 - (35%) Gaps:48/207 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC---------RST 115
            |:|..|:||..|:       |....:.::.|    .|.|.:|   .:...::|         |:|
  Rat    44 IINKHNQLRRTVS-------PSGSDLLRVEW----DHDAYVN---AQKWANRCIYNHSPLQHRTT 94

  Fly   116 ERFAYAGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIA 180
            .  ...|:|..:..|..:.:..         |::|:.|    |.:.:..|..:.....|..:|..
  Rat    95 T--LKCGENLFMANYPASWSSV---------IQDWYDE----SLDFVFGFGPKKVGVKVGHYTQV 144

  Fly   181 VAEKNTHVGCAAVRFSRDFYNHFVLTCNFAT-SNIVGQ--PVYTPGEKATTGCKNRYGAAYD--Y 240
            |......|.|...........:|.: |::.. .|.||:  ..||.||.    |.:..|...|  .
  Rat   145 VWNSTFLVACGVAECPDQPLKYFYV-CHYCPGGNYVGRLYSPYTEGEP----CDSCPGNCEDGLC 204

  Fly   241 PNLCYAKEIYDN 252
            .|.|..::.|.|
  Rat   205 TNSCEYEDNYSN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 29/158 (18%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 29/159 (18%)
Crisp 192..246 CDD:285731 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344817
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.