DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and pi15a

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:280 Identity:72/280 - (25%)
Similarity:100/280 - (35%) Gaps:72/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKCLILLTS-----LLGISLAADYCALP--TCLDKHIACNNKGNFSENCPKDVREVKIEPHHK 58
            :||..|:|..|     |.|.|..|. .:||  ...|...|.......:.|.||..|:..|..:..
Zfish     6 LAIDILLLCISCGASALAGFSPTAS-SSLPATNLTDIGFAPPKYLTEAANIPKTRRKRYISQNDM 69

  Fly    59 L-ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC------RSTE 116
            | ||:..|::|     ||:  .|.|..|..|.|.:.|:       ||.|.....|      |:..
Zfish    70 LAILDYHNKVR-----GKV--FPPASNMEYMVWDDTLA-------KTAEQWASTCIWEHGPRNLL 120

  Fly   117 RFAYAGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFP------EELPNKA-- 173
            ||  .|||     .|.....|..   |.:.::.|..|..:      .|||      ...|.|.  
Zfish   121 RF--LGQN-----LSVRTGRYRS---ILQLVKPWHDEVKD------YSFPYPRDCNPRCPLKCYG 169

  Fly   174 --VTKFTIAVAEKNTHVGCA----------AVRFSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEK 225
              .|.:|..|...:..||||          ...:.|..|    |.||:: ..|.:|:..|..|..
Zfish   170 PMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATY----LVCNYSPKGNWIGEAPYKVGVP 230

  Fly   226 ATTGCKNRYGAAYDYPNLCY 245
            .:. |...||.:.. .|:|:
Zfish   231 CSM-CPPSYGGSCS-NNMCF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 45/178 (25%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 44/176 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585791
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.