DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and r3hdml

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001373427.1 Gene:r3hdml / 561976 ZFINID:ZDB-GENE-090313-275 Length:252 Species:Danio rerio


Alignment Length:211 Identity:50/211 - (23%)
Similarity:78/211 - (36%) Gaps:46/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC---RSTERF-AY 120
            :|:..|.:|:.|       .|.|..|..|.|.|.|:       |:.|....:|   .....| .:
Zfish    69 LLDYHNRVRSQV-------FPPAANMEYMVWDERLA-------KSAEFWASQCIWEHGPHHFLQH 119

  Fly   121 AGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKN 185
            .|||.::.  ||......|.      :::|:.||.:      .|:|........|.:|..|...:
Zfish   120 IGQNLSII--SGRYKSIIDL------VKSWYDERHS------FSYPSRCSGSVCTHYTQMVWAAS 170

  Fly   186 THVGCAAVRFSRDFY------NHFVLTCNFA-TSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNL 243
            ..:|||..:.|..|.      ...:|.||:| ..|.||:..|..| :..:.|.:.||.:      
Zfish   171 NKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIG-RPCSACPSSYGGS------ 228

  Fly   244 CYAKEIYDNEKVIENT 259
            |...:.....|...||
Zfish   229 CNKNQCDSRPKSRRNT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 37/159 (23%)
r3hdmlNP_001373427.1 CAP_R3HDML 66..201 CDD:349409 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585749
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.