DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and PI15

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:230 Identity:54/230 - (23%)
Similarity:87/230 - (37%) Gaps:58/230 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SENCPKDVREVKIEPHHKL-ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKT 104
            |.:.||..|:..|..:..: ||:..|::|     ||:  .|.|..|..|.|.|.|:       |:
Human    50 SADIPKARRKRYISQNDMIAILDYHNQVR-----GKV--FPPAANMEYMVWDENLA-------KS 100

  Fly   105 CESLPDKC----RSTERFAYAGQNNALFQYSGAETEYTDAEIIKEQIENWFAE-RSNASPEILAS 164
            .|:....|    ..:....:.|||     .|.....|..   |.:.::.|:.| :..|.|     
Human   101 AEAWAATCIWDHGPSYLLRFLGQN-----LSVRTGRYRS---ILQLVKPWYDEVKDYAFP----- 152

  Fly   165 FPEELPNKA--------VTKFTIAVAEKNTHVGCA----------AVRFSRDFYNHFVLTCNFA- 210
            :|::...:.        .|.:|..|...:..:|||          ...:.|..|    |.||:| 
Human   153 YPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVY----LVCNYAP 213

  Fly   211 TSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCY 245
            ..|.:|:..|..|...:: |...||.:.. .|||:
Human   214 KGNWIGEAPYKVGVPCSS-CPPSYGGSCT-DNLCF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 38/175 (22%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 38/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151196
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.