DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and crispld1b

DIOPT Version :10

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_956764.2 Gene:crispld1b / 393442 ZFINID:ZDB-GENE-040426-1204 Length:509 Species:Danio rerio


Alignment Length:225 Identity:52/225 - (23%)
Similarity:76/225 - (33%) Gaps:83/225 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYA- 121
            :|||:|.|:||..|       .|.|..|..|.|..||.                 ||.|.:|:. 
Zfish    64 QLILDLHNKLRGQV-------YPPASNMEYMVWDTELE-----------------RSAEHWAHTC 104

  Fly   122 -------------GQNNALFQYSGAETEYTDAEIIKEQIENWFAE-RSNASPEILASFPEE---- 168
                         |||  |..:.|.:...|      ..::.|:.| |..:.|     :|:|    
Zfish   105 LWEHGPSHLLTRIGQN--LGAHWGRDRPPT------FHVQAWYDEVRDFSYP-----YPQECNPH 156

  Fly   169 ----LPNKAVTKFTIAVAEKNTHVGCAA-VRFSRDFYNHF-----VLTCNFA-TSNIVGQPVYTP 222
                ......|.:|..|...:..:|||. |.::.:.:...     .|.||:: ..|..|...|..
Zfish   157 CPYRCSGPVCTHYTQLVWATSNKIGCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKH 221

  Fly   223 GEKATT-------GCKNRYGAAYDYPNLCY 245
            |...:.       ||:|         ||||
Zfish   222 GTPCSACPPSYGGGCRN---------NLCY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 CAP_euk 57..210 CDD:349399 41/180 (23%)
crispld1bNP_956764.2 None

Return to query results.
Submit another query.