DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and CG8072

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster


Alignment Length:259 Identity:77/259 - (29%)
Similarity:117/259 - (45%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CLIL-LTSLLGISLAADYCALPTCLDK-HIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNEL 67
            |.|| |.|:|.|    |:|.:.:|..| ||.|:|...|.|:|.:....|.:....:.:|.|.|..
  Fly    11 CKILFLRSILAI----DFCDIKSCHGKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNGY 71

  Fly    68 RNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCE-SLP-DKCRSTERFAYAGQNNALFQY 130
            |..||......||.|.:|.::.|...||.:|..::|.|: .|| |.|.:|:.|     :...|.|
  Fly    72 RQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDF-----SEPHFNY 131

  Fly   131 SGAETEYTDAEIIKEQI-------ENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHV 188
              ||..|....|.:..:       |.|..|..:.......|...|:.|        .:.::::::
  Fly   132 --AEDFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAEGEIRN--------IINDRSSYM 186

  Fly   189 GCAAVRFSRDFYN-HFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYD 251
            ||||.: ..|.:| ||||.|.:::...|...:|..|....|.|.|  |.:.:|||||....:.|
  Fly   187 GCAAGQ-DYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCPN--GQSDEYPNLCKTLTLND 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 45/161 (28%)
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 45/162 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.