DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and CG34002

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:251 Identity:77/251 - (30%)
Similarity:114/251 - (45%) Gaps:25/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTSLLGISLA-----ADYCALPTC-LDK---HIACNNKGNFSENCPKDVREVKIEPH-HKLILNL 63
            |..|.|::|.     .:||.|..| .||   ||.|||.|::|..|.||.:.:.:..| .|||||.
  Fly    11 LLLLFGLNLVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILNH 75

  Fly    64 FNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLP-DKCRSTERFAYAGQNNAL 127
            .|..|:.||||::..||.|.||.|:.|..||:.||.:.||.|:..| |.|.|||.|:....:...
  Fly    76 HNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSYHAVY 140

  Fly   128 FQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAA 192
            .::...|..:   .|::.|:..|:.:..:.|...|.. ......|.:..|...:...:..:|||.
  Fly   141 NKFKAKEDTF---RIVRSQLNAWYDQYKHVSSSSLID-GLSTAKKEIGHFLRMIVGPSNRLGCAI 201

  Fly   193 VRFSRDFYNHFVLTCNFATSNIVGQPVY----TPGEKATTGCKNRYGAAYDYPNLC 244
            ....:..:.|..|.|.::.|......:|    .||...|||...:      :.|||
  Fly   202 ASIEKGGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGK------FQNLC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 46/152 (30%)
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 46/153 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455065
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.