powered by:
Protein Alignment scpr-B and CG34049
DIOPT Version :9
Sequence 1: | NP_650061.1 |
Gene: | scpr-B / 41357 |
FlyBaseID: | FBgn0037888 |
Length: | 262 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001033871.2 |
Gene: | CG34049 / 3885620 |
FlyBaseID: | FBgn0054049 |
Length: | 306 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 15/60 - (25%) |
Similarity: | 25/60 - (41%) |
Gaps: | 10/60 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 TSLLGISLAADYCALPTCLDKHIACNNKGNFSEN-CPK---------DVREVKIEPHHKL 59
:..||:.:|.|..::....:.|...|...:|.|| .|: |.:|.:...||.|
Fly 246 SEFLGVGVACDVSSIWIVCNYHPPGNVSEHFRENVLPRKFLLLKSDLDAKETRKSKHHNL 305
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45455113 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10334 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.940 |
|
Return to query results.
Submit another query.