DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and Glipr2

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_081726.1 Gene:Glipr2 / 384009 MGIID:1917770 Length:154 Species:Mus musculus


Alignment Length:166 Identity:33/166 - (19%)
Similarity:57/166 - (34%) Gaps:44/166 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSH------LALLNVKTCESLPDKCRSTERF 118
            :|...||.|..      .|:|      .:..|::|:.      .||.:.:..:..|:..|     
Mouse    13 VLKAHNEYRAQ------HGVP------PLKLCKKLNREAQQYSEALASTRILKHSPESSR----- 60

  Fly   119 AYAGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELP--NKAVTKFTIAV 181
            ...|:|.|...|.         :..|:..:.|::|        :.|:..:.|  ......||..|
Mouse    61 GQCGENLAWASYD---------QTGKDVADRWYSE--------IKSYNFQQPGFTSGTGHFTAMV 108

  Fly   182 AEKNTHVGCAAVRFSRDFYNHFVLTCNFATSNIVGQ 217
            .:....:|..  :.|....:.||:...|...|||.|
Mouse   109 WKNTKKIGVG--KASASDGSSFVVARYFPAGNIVNQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 28/157 (18%)
Glipr2NP_081726.1 CAP_GAPR1-like 8..139 CDD:349401 29/161 (18%)
Interaction with CAV1. /evidence=ECO:0000250 91..98 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.