DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and Clec18a

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_030099497.1 Gene:Clec18a / 353287 MGIID:2672935 Length:615 Species:Mus musculus


Alignment Length:259 Identity:60/259 - (23%)
Similarity:86/259 - (33%) Gaps:67/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNN 70
            |:||.|||||:........|.......|.:.|.:|                  |||...|.||:.
Mouse    94 LLLLLSLLGITWTEVQPPQPKQDPTLQALSRKESF------------------LILTAHNRLRSR 140

  Fly    71 VAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCES--LPDKCRSTERFAYAGQNNALFQYSGA 133
            |.       |.|..|.:|.|.|.|:.||......|.:  .|:...:....::.|.|..|.....|
Mouse   141 VH-------PPAANMQRMDWSESLAQLAEARAALCVTSVTPNLASTPGHNSHVGWNVQLMPMGSA 198

  Fly   134 ETEYTDAEIIKEQIENWFAE-----RSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAV 193
            .        ..|.:..||||     ..:|         |...|.....:|..|...::.:||...
Mouse   199 S--------FVEVVNLWFAEGLQYRHGDA---------ECAHNATCAHYTQLVWATSSQLGCGRQ 246

  Fly   194 RFSRDFYNHFVLTCNFATS---NIVGQPVYTPGEKAT---------TGCKNRYGAAYDYP-NLC 244
            ....|........|.::..   :|.|:.| .|.:|.|         :||..    |:|:. .||
Mouse   247 PCFVDQEAMEAFVCAYSPGGNWDINGKTV-APYKKGTWCSLCTARVSGCFK----AWDHAGGLC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 36/158 (23%)
Clec18aXP_030099497.1 CAP_euk 129..263 CDD:349399 36/157 (23%)
EGF_Lam 315..360 CDD:214543
CLECT 390..514 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.