DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and CG10651

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:263 Identity:80/263 - (30%)
Similarity:126/263 - (47%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKCLILLTSLLGI--SLAAD-YCALPTCLDKHIACNNKGNFSENCPKDVRE-VKIE-PHHKLILN 62
            |||:.||.|.|.|  :.|:| :|....|..:|:.|::.|||...|||.... ||:. ....||::
  Fly     2 IKCIWLLFSTLYIQDTGASDKWCKADLCRGQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVD 66

  Fly    63 LFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAL 127
            ..||.||..||| ::..|||.||..:.|..||:.:|...|:.||.:.|:|..|..:.:|..:.:|
  Fly    67 KHNEYRNKFAGG-MDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSL 130

  Fly   128 FQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASF------PEELPNKAVTKFTIAVAEKNT 186
            .:|....|:   .|.:::|:::||  ..|:..|:...|      .:||..    .:...:.::..
  Fly   131 EKYFCMTTK---KEALRKQLDHWF--DPNSKDEVQKLFFSWTKNQQELSK----NYFQVLRDRAN 186

  Fly   187 HVGCAAVRFSRDFYNHFVL----TCNFATSNIVGQPVY-TPGEKATTGCKNRYGAAYDYPNLCYA 246
            .||||.|.:.|....|.:|    .|..:.......||| ...|:|.:.|..  |:...|.|||:.
  Fly   187 RVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMK--GSNKQYKNLCHK 249

  Fly   247 KEI 249
            .|:
  Fly   250 DEL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 46/161 (29%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 45/158 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440658
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.