DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and CG16995

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster


Alignment Length:92 Identity:17/92 - (18%)
Similarity:31/92 - (33%) Gaps:22/92 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 AGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSN---ASPEILASFPEELPNKAVTKFTIAVA 182
            :|....::..||...:..||      :.:|:.|...   .||....:         ...||..|.
  Fly    55 SGYGENIYMASGGNLKGADA------VRSWYEEIRQYNWNSPSFQGN---------TGHFTQVVW 104

  Fly   183 EKNTHVGCAAVRFSRDFYNHFVLTCNF 209
            :.:|.:|....:.....|    :.||:
  Fly   105 KSSTELGVGFAKSGSTIY----VVCNY 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 17/92 (18%)
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 15/88 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.