DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and glipr2

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021327299.1 Gene:glipr2 / 325699 ZFINID:ZDB-GENE-030131-4424 Length:543 Species:Danio rerio


Alignment Length:105 Identity:24/105 - (22%)
Similarity:38/105 - (36%) Gaps:29/105 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELP--NKAVTKFTIAVAEKNTH 187
            |..:.||.|..:.|.    :|.:|:|:.|        :..:....|  ......||..|.:.:..
Zfish   250 NVYYAYSSANKKLTG----REAVESWYNE--------IKEYNFSRPGFTSKTGHFTQVVWKDSKE 302

  Fly   188 VGCAAVRFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKAT 227
            :|..             |..:.:||.:|||  |.||...|
Zfish   303 LGVG-------------LATDGSTSFVVGQ--YLPGGNIT 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 15/86 (17%)
glipr2XP_021327299.1 SCP_GAPR-1_like 5..135 CDD:240182
SCP_GAPR-1_like 196..326 CDD:240182 23/102 (23%)
SCP_GAPR-1_like 397..528 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.