DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and CG32679

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster


Alignment Length:259 Identity:97/259 - (37%)
Similarity:134/259 - (51%) Gaps:28/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CLILLTSLLGI----SLAADYCALPTC-LDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLF 64
            |.|.|..|:.|    :.|.:||....| ..:|:||.|.|.|...|..:.  |:::.|..|||.|.
  Fly     6 CWIFLLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEF--VQVDAHIPLILQLH 68

  Fly    65 NELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQN-NALF 128
            ||.||.:|||.:.|.|.||:||.|||...|:.||..|...|....|:||:|..:.||||| :.||
  Fly    69 NERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSILF 133

  Fly   129 QYSGAETEYTD-AEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAA 192
                  |...| |..::::|..||.|..:|:...:..: :.....|:..||..|.|:|..||||.
  Fly   134 ------TRSVDVAVFLRQRIAAWFDENRDATSGDMEDY-QMRGGPAIGHFTTMVNERNNRVGCAI 191

  Fly   193 VRFSRDFYN--HFVLTCNFATSNIVGQPVYTPGEKA---TTGCKNRYGAAYDYPNLCYAKEIYD 251
            .||: |..|  ..:|.||:|.:|:|..|||..|..|   |||..:      :|||||...|:|:
  Fly   192 ARFT-DANNVQATLLACNYAVTNVVNNPVYRAGTAASECTTGRNS------NYPNLCSPNEVYN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 61/155 (39%)
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 61/154 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440553
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.