DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and Crispld1

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:281 Identity:66/281 - (23%)
Similarity:103/281 - (36%) Gaps:63/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTSLLGISLAADYCALPTC------LDKHI-------ACNNKGN--FSENCPKDVREVKIEPHHK 58
            :|:||.::.|.....:|..      |:|::       ....:|.  .::|   |::.        
  Rat    11 MTALLFVARAVPAMVVPNATLLEKLLEKYMDEDDEWWTAKQRGKRAITDN---DMQS-------- 64

  Fly    59 LILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPDKCRSTERFAYA 121
             ||:|.|:||:.|       .|.|..|..|:|..||...|....:||  |..|     |......
  Rat    65 -ILDLHNKLRSQV-------YPAASNMEYMTWDVELERSAESWAETCLWEHGP-----TSLLPSI 116

  Fly   122 GQNNALFQYSGAETEYTDAEIIKEQIENWFAE-RSNASP---EILASFPEELPNKAVTKFTIAVA 182
            |||  |..:.|.....|      ..::.|:.| |..:.|   |.....|........|.:|..|.
  Rat   117 GQN--LGAHWGRYRPPT------FHVQAWYDEVRDFSYPYEHECDPYCPFRCSGPVCTHYTQVVW 173

  Fly   183 EKNTHVGCAA-VRFSRDFYNHF-----VLTCNFA-TSNIVGQPVYTPGEKATTGCKNRYGAAYDY 240
            ..::.:|||. :..:.:.:...     .|.||:: ..|..|...|..| |..:.|...:|... .
  Rat   174 ATSSRIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHG-KPCSACPPSFGGGC-R 236

  Fly   241 PNLCYAKEIYDNEKVIENTQT 261
            .|||| ||..|.....:..:|
  Rat   237 ENLCY-KEGSDQYYTPQEEET 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 41/163 (25%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 41/172 (24%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344628
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.