DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:266 Identity:62/266 - (23%)
Similarity:94/266 - (35%) Gaps:73/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKCLILLTSLLGISLAADYCA-LPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLF 64
            ||:|.......:||:.|.|...: :|:..|.|        |.:||        ||.|        
Human    86 MALKNKFSCLWILGLCLVATTSSKIPSITDPH--------FIDNC--------IEAH-------- 126

  Fly    65 NELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC-----RSTERFAYAGQN 124
            ||.|     ||:.  |.|..|..|.|.:.|:.:|......|:...:.|     :....|.|.|:|
Human   127 NEWR-----GKVN--PPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGEN 184

  Fly   125 NALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVG 189
            ..|    |....:|.    :..|..|:.|..      ...|.....::....:|..|...:.:||
Human   185 IWL----GGIKSFTP----RHAITAWYNETQ------FYDFDSLSCSRVCGHYTQLVWANSFYVG 235

  Fly   190 CA-AVRFSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYDN 252
            || |:..:....:..:..||:. ..|....|.|..||..               :|| :||    
Human   236 CAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESC---------------SLC-SKE---- 280

  Fly   253 EKVIEN 258
            ||.::|
Human   281 EKCVKN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 34/157 (22%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151301
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.