DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and antr

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster


Alignment Length:243 Identity:54/243 - (22%)
Similarity:95/243 - (39%) Gaps:11/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YCALPTCLDK--HIACNNKGNFSENCPKDVREVKIEPHHKL-ILNLFNELRNNVAGGKIEGLPKA 82
            :|....|::.  |:.|.......|.|.|:...:.:....|. ||:..|.|||.||.| :.....|
  Fly    24 HCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTGILSRINMLRNYVASG-VGNYSVA 87

  Fly    83 VRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEQI 147
            .||..|.|..||..||...|:.|:.....|.:|:::.|.....  .:.....|:...:.|:.:.:
  Fly    88 ARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTE--IRSKMGRTKSLKSAILDKLL 150

  Fly   148 ENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCA-AVRFSRDFYNHFVLTCNFAT 211
            ...|.:............|.. ....|..:...:.:..:.:||. .|:...:..::.:|.|:|:.
  Fly   151 PELFLDVMGCMMNSQKLVPVR-EGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSR 214

  Fly   212 SNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYD-NEKVIEN 258
            :::.....|..|:.....|..  |.:..|..||...|..| |..|:|:
  Fly   215 ASVNNLVPYEEGQIPAGKCAT--GPSQMYQFLCSEDEYVDANSMVVES 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 34/153 (22%)
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 34/153 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440652
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.