DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and scl-21

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_507793.1 Gene:scl-21 / 189870 WormBaseID:WBGene00012816 Length:198 Species:Caenorhabditis elegans


Alignment Length:192 Identity:47/192 - (24%)
Similarity:65/192 - (33%) Gaps:50/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KLILNLFNELRNNVAGGK-------IEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRST 115
            |.|:...|:||:.||..:       :|.||.|..|.||:|...|:..|....|||          
 Worm    24 KEIVTYINDLRSLVASRRFHLDSRDVETLPPASDMLKMTWNSTLAVAAQKLAKTC---------- 78

  Fly   116 ERFAYAGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIA 180
                       ......:.....|..|:   ..|......||......|..:|...|:.....|.
 Worm    79 -----------FIAVESSSPGIADKRIV---AANVVTVAKNALGHWKHSLNKEWNLKSYNSNYIG 129

  Fly   181 VA---EKNTHVGCAAVRFS--------RDFYNHFVLTCNF-ATSNIVGQPVYTPGEKATTGC 230
            :.   .|::.|||.   ||        |.:|.   :.|:| ....|..:|||..| ||...|
 Worm   130 IQLIWAKSSSVGCG---FSPCEIDSQGRRWYK---VVCSFEKKGGITREPVYKKG-KACEAC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 39/170 (23%)
scl-21NP_507793.1 CAP_euk 23..163 CDD:349399 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.