DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and C07A4.3

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_509707.2 Gene:C07A4.3 / 182352 WormBaseID:WBGene00007398 Length:207 Species:Caenorhabditis elegans


Alignment Length:200 Identity:42/200 - (21%)
Similarity:71/200 - (35%) Gaps:48/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDK 111
            |..|..|:...|.|::..|:.|.:.:...:........:|: .|.:|:            :...|
 Worm    35 DPAEYSIKDLKKWIVHFHNKYRAHHSSPAVTVDSNLTNLAQ-KWSDEM------------AFHKK 86

  Fly   112 CRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEQIENWFAE-------RSN-ASPEILASFPEE 168
            |...|:.:..|:|...|..|...:..|.|..:   |..::.|       |.| .|...:..|.:.
 Worm    87 CLVHEQPSKYGENLTSFASSKFPSPKTCAAAL---IHGFYTEGYGFNYTRFNPGSWSKVGHFTQL 148

  Fly   169 L-PNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTC-------NFATSNIVGQPVYTPGEK 225
            | .|.......::||::.|            .|:.:|  |       |..||......|..|  |
 Worm   149 LWKNSRKIGVGVSVAKRGT------------MYHVYV--CIKYDPPGNMQTSEAYMDNVRAP--K 197

  Fly   226 ATTGC 230
            :|:||
 Worm   198 STSGC 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 31/167 (19%)
C07A4.3NP_509707.2 CAP_GAPR1-like 43..183 CDD:349401 30/169 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.