DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and scl-5

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_502506.1 Gene:scl-5 / 178253 WormBaseID:WBGene00008027 Length:208 Species:Caenorhabditis elegans


Alignment Length:202 Identity:47/202 - (23%)
Similarity:78/202 - (38%) Gaps:49/202 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGG----KIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAY 120
            |||:.|.||:.:|.|    |....|.|..|.||.|...::       .:.::..:|| .|.....
 Worm    27 ILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVA-------ASAQAYANKC-PTGHSGA 83

  Fly   121 AGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKN 185
            ||....|:.|      :|.|.|  ..|:.:.|..|       |::.:|..:...:..|::::..|
 Worm    84 AGLGENLYWY------WTSATI--TNIDQFGATGS-------AAWEKEFQDYGWSSNTLSMSLFN 133

  Fly   186 T---H-----------VGCAAVRFSRDF--YNHFVLTCNF-ATSNIVGQPVYTPGEKAT-----T 228
            |   |           :||......:|.  :|...:.|.: ...|.:.|.:||.|...:     |
 Worm   134 TGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGT 198

  Fly   229 GCKNRYG 235
            .|:...|
 Worm   199 SCEAATG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 39/170 (23%)
scl-5NP_502506.1 SCP 22..175 CDD:214553 39/170 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.