DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and scl-2

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_502503.1 Gene:scl-2 / 178251 WormBaseID:WBGene00009895 Length:207 Species:Caenorhabditis elegans


Alignment Length:250 Identity:50/250 - (20%)
Similarity:80/250 - (32%) Gaps:70/250 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNV 71
            :||...|.:..:||:                |:..:|.               |:|..|.||:.:
 Worm     4 LLLVVALAVGCSADF----------------GSSGQNG---------------IINAHNTLRSKI 37

  Fly    72 AGGK--IEGLPKA--VRMAKMSWCEELSHLALLNVKTCES--LPDKCRSTERFAY--AGQNNALF 128
            |.|.  .:|..|:  ..:.||.|...::..|......|.:  ..|.......:.|  :|....|.
 Worm    38 AKGTYVAKGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHSGDAGLGENLYWYWTSGSLGDLN 102

  Fly   129 QYSGA-----ETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHV 188
            ||..|     |.|:.|           :..:||.       ...:|.|..:...|.....|:..:
 Worm   103 QYGSAASASWEKEFQD-----------YGWKSNL-------MTIDLFNTGIGHATQMAWAKSNLI 149

  Fly   189 GCAAVRFSRDF--YNHFVLTCNF-ATSNIVGQPVYTPGEKAT-----TGCKNRYG 235
            ||......||.  .|...:.|.: ...|.:.|.:|..|...:     |.|:...|
 Worm   150 GCGVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSCETSTG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 36/167 (22%)
scl-2NP_502503.1 SCP 21..174 CDD:214553 37/185 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.