DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and lon-1

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:317 Identity:72/317 - (22%)
Similarity:98/317 - (30%) Gaps:106/317 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLTSLLG----ISLAADYCALPTCLDKHIACNNKGNFSENCPKDV-------REVKIE------P 55
            |||:|:.    ||:|.:   :|     |.....:...|.:.|.|:       .|||.|      |
 Worm     4 LLTALIALLAPISVAYN---VP-----HGFLTGEAVTSHSGPNDLDGELPATDEVKREKRGYFFP 60

  Fly    56 HH-------------------KLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLN 101
            .|                   |.|.:..|..|..|         .|..|..:.|.:||:..|..:
 Worm    61 SHFQSDSGLLSRSEHPNEYLKKWITHEHNRYRRMV---------PASDMNMLYWSDELAASAQRH 116

  Fly   102 VKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFP 166
            ..||:....:.|..     .|:|.....||    .|:||      |..||.|..|         |
 Worm   117 ADTCDFRHSRGRIN-----VGENIWAAPYS----NYSDA------ISIWFNEVHN---------P 157

  Fly   167 EELPNKAVT----KFTIAVAEKNTHVGCAAVR-------FSRDFYNHFVLTCNF----------A 210
            ....|.|..    .:...|..|...|||...|       :.|...|.||  |::          |
 Worm   158 RCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFV--CHYNPQGNTVFVTA 220

  Fly   211 TSNIVGQPVYTPGEKATTGCKN-RYGAAYDYPNLCYAKEIYD-----NEKVIENTQT 261
            ...:...|.:|........|.| ...|...|..|||..:.|:     .|....:|.|
 Worm   221 RGQLYAMPAFTWASGDNGKCSNCPANAPACYQGLCYMPKNYEAPTTTTESTTTSTTT 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 40/172 (23%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 40/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.