DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and R3HDML

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_848586.1 Gene:R3HDML / 140902 HGNCID:16249 Length:253 Species:Homo sapiens


Alignment Length:201 Identity:45/201 - (22%)
Similarity:76/201 - (37%) Gaps:39/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC----RSTERFAY 120
            :|:..|.:|.:|       .|.|..|..|.|.:.|:..|       |:...:|    ..::...|
Human    66 LLDYHNHIRASV-------YPPAANMEYMVWDKRLARAA-------EAWATQCIWAHGPSQLMRY 116

  Fly   121 AGQNNALFQYSGAETEYTDAEIIKE-QIENW---FAERSNASPEILASFPEELPNKAVTKFTIAV 181
            .|||.::  :||......|  ::|. ..|.|   |....:.:|..    |........:.:|..|
Human   117 VGQNLSI--HSGQYRSVVD--LMKSWSEEKWHYLFPAPRDCNPHC----PWRCDGPTCSHYTQMV 173

  Fly   182 AEKNTHVGCAAVRFS------RDFYNHFVLTCNFA-TSNIVGQPVYTPGEKATTGCKNRYGAAYD 239
            ...:..:|||....|      ..::....|.||:| ..|.:|:..|..| |..:.|...|..:.:
Human   174 WASSNRLGCAIHTCSSISVWGNTWHRAAYLVCNYAIKGNWIGESPYKMG-KPCSSCPPSYQGSCN 237

  Fly   240 YPNLCY 245
             .|:|:
Human   238 -SNMCF 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 35/163 (21%)
R3HDMLNP_848586.1 SCP 65..207 CDD:320774 34/162 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151175
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.