DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and LOC1269647

DIOPT Version :10

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001687886.2 Gene:LOC1269647 / 1269647 VectorBaseID:AGAMI1_014096 Length:147 Species:Anopheles gambiae


Alignment Length:53 Identity:11/53 - (20%)
Similarity:30/53 - (56%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIVVLFGVASQITSALYLKQADFDDPRMFTSSFGKRSAIESEPQAYPKSYRAI 60
            ::::|..:.....:|::|.:.:.:|..| .:.:|....:||:   ||::::.|
Mosquito   198 VLLLLLSLYLAFPNAVFLNRGNHEDSVM-NARYGFIREVESK---YPRNHKRI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 CAP_euk 57..210 CDD:349399 1/4 (25%)
LOC1269647XP_001687886.2 None

Return to query results.
Submit another query.