DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and glipr1a

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a / 108179203 ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio


Alignment Length:265 Identity:61/265 - (23%)
Similarity:94/265 - (35%) Gaps:83/265 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CLILLTS---LLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNE 66
            |..||.|   |||: .:::|  |....|:        .|.:.|   |||             .|:
Zfish     4 CFQLLISACFLLGV-FSSEY--LFDITDR--------AFIDEC---VRE-------------HNQ 41

  Fly    67 LRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC-----ESLPDKCRSTERFAYAGQNNA 126
            .|::|:       |.|..|..|:|...|:..|....:.|     ..|.:..|....|...|:|  
Zfish    42 NRSSVS-------PTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGEN-- 97

  Fly   127 LFQYSGAE-TEYTDAEIIKEQIENWFAE------RSNASPEILASFPEELPNKAVTKFTIAVAEK 184
              .::||. :.:|    :|..:.:|..|      .:|...:          .|....:|..|...
Zfish    98 --IWAGAPYSRFT----VKSAVFSWVNELKDYNYNNNQCND----------KKVCGHYTQVVWAD 146

  Fly   185 NTHVGCAA---------VRFSRDFYNHFVLTCNFATS-NIVGQPVYTPGEKATTGCKNRYGAAYD 239
            :..||||.         ..||.  ....:..||:||: |..|:..|..| .:.:||.   |:...
Zfish   147 SYKVGCAVQTCPNGVAETHFSN--IQGVIFVCNYATAGNFAGRSPYKQG-ASCSGCG---GSDKC 205

  Fly   240 YPNLC 244
            ..|||
Zfish   206 ERNLC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 34/172 (20%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.