DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and LOC101883528

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 / 101883528 -ID:- Length:261 Species:Danio rerio


Alignment Length:207 Identity:51/207 - (24%)
Similarity:76/207 - (36%) Gaps:56/207 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPDKCRSTERFAYAG 122
            |::|.||||:.|.       |.|..|.|:.|.|.:..:|......|  :..||....|     .|
Zfish    31 IVDLHNELRSQVQ-------PSAAFMQKVVWDETIRLVAEGYAAKCIWDHNPDLEHLT-----MG 83

  Fly   123 QNNALFQYSGAETEYTDAEIIKEQIENWFAE------RSNASPEILASFPEELPNKAVTKFTIAV 181
            :|  ||..:|...       ..:.:.:||.|      .:|...|          :|....:|..|
Zfish    84 EN--LFVGTGPFN-------ATKAVMDWFNENLDYNYNTNDCAE----------DKMCGHYTQLV 129

  Fly   182 AEKNTHVGCAAVRFSRDFYNHF----VLTCN-FATSNIVGQPVYTPGE---KATTGCKNRYGAAY 238
            ....|.:|||:.........||    :|.|: :...||.||..|..||   |....|:|      
Zfish   130 WANTTKIGCASYFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESGESCSKCPEECEN------ 188

  Fly   239 DYPNLCYAKEIY 250
               |:|..:.::
Zfish   189 ---NICVMENLF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 39/162 (24%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 39/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.