DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and CG42780

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster


Alignment Length:247 Identity:79/247 - (31%)
Similarity:121/247 - (48%) Gaps:12/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLTSLLGISLAADYCALPTCL--DKHIACNN-KGNFSENCPKDVREVKIEPHHK-LILNLFNEL 67
            |.:.||:..|||.::|....|.  ..||||.| .|:|..:||||...:|:....| .::...|.:
  Fly     8 IFVLSLVLHSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLV 72

  Fly    68 RNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSG 132
            |...|.||.:....|.:||||.|.::|..||:||.|||....|:|.:||:|..:|||.....:|.
  Fly    73 RQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSH 137

  Fly   133 A-----ETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAA 192
            |     :...|.:.:.:..::.|..|..:.:.|.|...... |.:.:...|:.:.||:..|||..
  Fly   138 ARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPN-PPEVIGHLTVLINEKSNAVGCGL 201

  Fly   193 VRFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLC 244
            |.::......:.|.||:|.:|::|:.||....||...|..  |....||.||
  Fly   202 VAYNLGEIRRYNLACNYAYTNVIGERVYEECAKAGIECAK--GIDQKYPPLC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 46/157 (29%)
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 46/157 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440556
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.