DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and serotriflin

DIOPT Version :10

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017949574.2 Gene:serotriflin / 101732829 XenbaseID:XB-GENE-29209244 Length:290 Species:Xenopus tropicalis


Alignment Length:43 Identity:9/43 - (20%)
Similarity:18/43 - (41%) Gaps:7/43 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKRSAIESEPQAYPKSYRAIRIQR-------RSMDDLDDPRLM 76
            |..:.::.|..:|...:.|...:|       :..|:|.|..:|
 Frog   140 GHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIM 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 CAP_euk 57..210 CDD:349399 6/27 (22%)
serotriflinXP_017949574.2 CAP 80..217 CDD:412178 9/43 (21%)
Crisp 234..289 CDD:462519
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.