DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and crisp2-like

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001188271.2 Gene:crisp2-like / 100495843 -ID:- Length:207 Species:Xenopus tropicalis


Alignment Length:178 Identity:44/178 - (24%)
Similarity:71/178 - (39%) Gaps:44/178 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC-----RSTER-- 117
            :::|.|.||.:|.       |.|..|.||.|    |..|.||.:...:   ||     .:|||  
 Frog    38 LVDLHNLLRRSVD-------PTAKDMLKMEW----SPGAALNAQNAAA---KCVMQHSSATERQI 88

  Fly   118 ---FAY-AGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPN--KAVTK 176
               |.| .|:|   ...:.|:.::..|      :.:||.||::.:..:       .||  |.:..
 Frog    89 QDPFNYVCGEN---IYVTTAKPDWAAA------VNSWFNERNDFTYGV-------GPNSDKMIGH 137

  Fly   177 FTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNFATSNIVGQPVYTPGE 224
            :|.....|...:|| .:.|....|..:|..|::.....:...:.||.|
 Frog   138 YTQVAWAKTYLLGC-GLAFCPGNYYPYVSICHYCPMGNMINSIKTPYE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 41/162 (25%)
crisp2-likeNP_001188271.2 SCP 33..171 CDD:320774 41/163 (25%)
Crisp 189..>205 CDD:312162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.