DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and LOC100490275

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031754789.1 Gene:LOC100490275 / 100490275 -ID:- Length:291 Species:Xenopus tropicalis


Alignment Length:231 Identity:57/231 - (24%)
Similarity:84/231 - (36%) Gaps:66/231 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTE----RFAY 120
            ::|..|::||..  ||     :|..|..|||...|:.||......|:.:|:...:.|    ||..
 Frog    33 LVNAHNDIRNEF--GK-----QAANMLHMSWDVGLAKLAQAWTINCKKVPNPHLNKESIYPRFKQ 90

  Fly   121 AGQNNALFQYSGAETEYTDAEIIKEQIENW-----FAERSNASPEILASFPEELPNKAVTKFTIA 180
            .|:|    .|.|...:      |.:.:.||     |.:..|.|.:         |.|..:.||..
 Frog    91 IGEN----LYMGPSID------IFKIVTNWGLEGNFYDLKNNSCQ---------PGKDCSHFTQI 136

  Fly   181 VAEKNTHVGCAAVRFSRDFYNH---FVLTCNFA-TSNIVGQPVYTPGEKAT---------TGCKN 232
            |......|||.|.     :..|   :|::|.:. ..|::||..:..|.|.:         ..|.|
 Frog   137 VWANTYKVGCGAA-----YCAHKVAYVVSCTYGPRGNLLGQVPFILGVKCSKCGGEKCNVASCGN 196

  Fly   233 -----RYG--------AAYDYPNLCYAKEIYDNEKV 255
                 .||        |..|...|.......:||||
 Frog   197 PSRDENYGDYNYCPPFATIDCYRLSKGNVRVNNEKV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 41/161 (25%)
LOC100490275XP_031754789.1 CAP 28..167 CDD:412178 41/164 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.