DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and pi15

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:275 Identity:66/275 - (24%)
Similarity:105/275 - (38%) Gaps:67/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLTSLLGISLAADYC--ALPTCLDKHIACNN----KGNFS-----ENCPKDVREVKIEPHHKL 59
            ::.:::...:||..:.|  .||...|...|.:|    |.:.|     ...||..|:..|..:..:
 Frog     4 MVSISAAFLLSLLCETCGLVLPKSSDLASAASNYTIIKPDLSARLDAAKVPKARRKRYISQNDMI 68

  Fly    60 -ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPDKCRSTERFAYA 121
             |:...|::|     ||:  .|.|..|..|.|.|.|:.||.....||  :..|     :....:.
 Frog    69 AIVEYHNQVR-----GKV--FPPAANMEYMVWDENLAKLAEAWAATCIWDHGP-----SYLLKFL 121

  Fly   122 GQNNALFQYSGAETEYTDAEIIKEQIENWFAE-RSNASPEILASFPEELPNKA--------VTKF 177
            |||     .|.....|   :.|.:.::.|:.| :..|.|     :|:|...:.        .|.:
 Frog   122 GQN-----LSVRTGRY---KSILQLVKPWYDEVKDYAFP-----YPQECNPRCPLRCYGPMCTHY 173

  Fly   178 TIAVAEKNTHVGCA-----------AVRFSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEKATTGC 230
            |..|......:|||           || :.|..|    |.||:: ..|.:|:..||.|... :.|
 Frog   174 TQMVWATTNRIGCAIHTCHNMNVWGAV-WRRAVY----LVCNYSPKGNWIGEAPYTIGVPC-SAC 232

  Fly   231 KNRYGAAYDYPNLCY 245
            ...||.:.. .|.|:
 Frog   233 PPSYGGSCS-DNQCF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 42/174 (24%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 42/174 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.