Sequence 1: | NP_650060.1 | Gene: | CG31388 / 41355 | FlyBaseID: | FBgn0051388 | Length: | 446 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079109.2 | Gene: | ZNF671 / 79891 | HGNCID: | 26279 | Length: | 534 | Species: | Homo sapiens |
Alignment Length: | 228 | Identity: | 66/228 - (28%) |
---|---|---|---|
Similarity: | 101/228 - (44%) | Gaps: | 16/228 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 195 HTCSKCGLEFENVDELKLH-KYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTHSCTK 258
Fly 259 CKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYT 323
Fly 324 AAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRT 388
Fly 389 HQKYHNLTRDHGCEICRISF----KTAKHYRSH 417 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31388 | NP_650060.1 | zf-AD | 4..76 | CDD:285071 | |
C2H2 Zn finger | 228..254 | CDD:275368 | 5/25 (20%) | ||
C2H2 Zn finger | 286..306 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 314..334 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 342..363 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 373..393 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 401..419 | CDD:275368 | 5/21 (24%) | ||
ZNF671 | NP_079109.2 | KRAB | 49..109 | CDD:214630 | |
KRAB | 49..88 | CDD:279668 | |||
C2H2 Zn finger | 243..269 | CDD:275368 | |||
COG5048 | <285..443 | CDD:227381 | 49/164 (30%) | ||
zf-C2H2 | 285..307 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 287..307 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 300..324 | CDD:290200 | 7/27 (26%) | ||
C2H2 Zn finger | 315..335 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 327..352 | CDD:290200 | 5/24 (21%) | ||
C2H2 Zn finger | 343..363 | CDD:275368 | 5/21 (24%) | ||
zf-C2H2 | 369..391 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 371..391 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 397..419 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 399..419 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 412..436 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 427..447 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 453..473 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 466..490 | CDD:290200 | 7/23 (30%) | ||
C2H2 Zn finger | 481..501 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 509..529 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |