DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and ZNF212

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_036388.2 Gene:ZNF212 / 7988 HGNCID:13004 Length:495 Species:Homo sapiens


Alignment Length:462 Identity:105/462 - (22%)
Similarity:144/462 - (31%) Gaps:179/462 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RQIETLTNL------------------------QLKEDGKLPRFMC---------QDCQHDLQIA 61
            |::|.:.||                        .|:.||     :|         :|.|.:|   
Human   109 RRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDG-----VCFTEQEWENLEDWQKEL--- 165

  Fly    62 IDFRRVCIEAQE-LLELQ-LRQVEKEEEAFESLAEQWLDDCPDE-LSNLSPVLQLNDRMDFIFDP 123
              :|.|.....| |:.|: |.|.|.|.|    |..:.|.|..:| .....|...:..:.:..:..
Human   166 --YRNVMESNYETLVSLKVLGQTEGEAE----LGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQ 224

  Fly   124 E-PQDKNTDELASIKTTTTTEYMNAYQSVASPQS--SPELST--DSQLSNEHFDMGLSPESEPES 183
            | |.|                ....:..:|..|:  |||.:.  ..|.|:...:.|  |......
Human   225 EGPAD----------------LPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETG--PGDSTLE 271

  Fly   184 EAIDNRDTSSSHT--CSK------------CGLEFENVDELKLHKYHLHDIPPDTK--FVCDHCD 232
            |.:.:|..|||.|  |.|            ||      ..|||.|        ||.  :.|..|:
Human   272 EPVGSRVPSSSRTVGCPKQKSHRQVQLDQECG------QGLKLKK--------DTSRPYECSECE 322

  Fly   233 EGFRSAAALTRHCNMINLPLTH----SCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHL 293
            ..||....|..|..      :|    |||            ....:..|||..            
Human   323 ITFRYKQQLATHLR------SHSGWGSCT------------PEEPEESLRPRP------------ 357

  Fly   294 TTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERP------------------- 339
                .||....:   .:.|:||.|..||.....|.:||:.|..|.|                   
Human   358 ----RLKPQTKK---AKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALP 415

  Fly   340 -----------YICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQKYH 393
                       .||.| |||:|...|....|:|:|  ..:|.|.|..|.||:|.......|||.|
Human   416 GHIPWRKSRSSLICGY-CGKSFSHPSDLVRHQRIH--TGERPYSCTECEKSFVQKQHLLQHQKIH 477

  Fly   394 NLTRDHG 400
            .  |:.|
Human   478 Q--RERG 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 15/79 (19%)
C2H2 Zn finger 228..254 CDD:275368 6/25 (24%)
C2H2 Zn finger 286..306 CDD:275368 2/19 (11%)
C2H2 Zn finger 314..334 CDD:275368 8/19 (42%)
C2H2 Zn finger 342..363 CDD:275368 9/20 (45%)
C2H2 Zn finger 373..393 CDD:275368 8/19 (42%)
C2H2 Zn finger 401..419 CDD:275368 105/462 (23%)
ZNF212NP_036388.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
KRAB_A-box 142..180 CDD:143639 11/47 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..290 9/27 (33%)
C2H2 Zn finger 318..338 CDD:275370 6/25 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 337..361 8/51 (16%)
COG5048 <367..479 CDD:227381 34/116 (29%)
C2H2 Zn finger 371..391 CDD:275368 8/19 (42%)
C2H2 Zn finger 429..449 CDD:275368 9/20 (45%)
zf-C2H2 429..449 CDD:306579 9/20 (45%)
zf-H2C2_2 441..466 CDD:316026 9/26 (35%)
C2H2 Zn finger 457..477 CDD:275368 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..495 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.