DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and E4f1

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001171975.1 Gene:E4f1 / 681359 RGDID:1596731 Length:783 Species:Rattus norvegicus


Alignment Length:392 Identity:85/392 - (21%)
Similarity:129/392 - (32%) Gaps:146/392 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 SNEHFDMGLSPESE-PESEAIDNRD-----------------------TSSS---HTCSKCGLEF 204
            |..|.::||..|.| .:.:.:.|::                       |.||   |.|..||..|
  Rat   166 SPNHQELGLIGEGEQAQVKLLVNKEGRYVCMLCHKTFKTGSILKAHMVTHSSRKDHECKLCGASF 230

  Fly   205 ENVDEL-KLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRH------CN---------------- 246
            .....| :.|:.|..:.|    :.|..|.:.||.:.|||||      |.                
  Rat   231 RTKGSLIRHHRRHTDERP----YKCAKCGKSFRESGALTRHLKSLTPCTEKIRFSISKDTAVGKE 291

  Fly   247 ----------------------MINLPLTHSCTKCKSQFHNHILLETHKQR-------------- 275
                                  |...|:.|..|..|..    ::.|.|.|.              
  Rat   292 EVPAGSSASTVGTVTSSVAGEPMETSPVIHLVTDAKGT----VIHEVHVQMQELPLGMKALTPES 352

  Fly   276 -------CLRPPASQHVCH------------ICGKH------------------------LTTAF 297
                   |.|..:.:::.|            :.|:.                        |....
  Rat   353 ADCEELPCSRENSRENLLHQAMQNSGIVLDRVAGEESTLQPAPPSGSSPQSLGDGPSELPLLEVE 417

  Fly   298 NLKNHLVRHAGT--RRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHE 360
            .::..:...|.|  |.|.|.|||.:|.:||.|.:|::.|...||:.|. .|||.|........|:
  Rat   418 QIETQVASEAATVPRTHPCSQCSETFPSAATLEAHKRGHIGPRPFTCT-QCGKAFPKAYLLKKHQ 481

  Fly   361 RVHMDASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAK----HYRSHLKSN 421
            .||:  .:|.::|..|.|.|.|.:..|.|::.|:..|...|..|...:||..    |:|:||:..
  Rat   482 EVHV--HERRFRCGDCGKLYKTIAHVRGHRRVHSDERPFPCPQCGKRYKTKNAQQVHFRTHLEEK 544

  Fly   422 AH 423
            .|
  Rat   545 PH 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 12/69 (17%)
C2H2 Zn finger 286..306 CDD:275368 3/55 (5%)
C2H2 Zn finger 314..334 CDD:275368 9/19 (47%)
C2H2 Zn finger 342..363 CDD:275368 6/20 (30%)
C2H2 Zn finger 373..393 CDD:275368 7/19 (37%)
C2H2 Zn finger 401..419 CDD:275368 7/21 (33%)
E4f1NP_001171975.1 COG5048 193..594 CDD:227381 78/365 (21%)
C2H2 Zn finger 195..215 CDD:275368 0/19 (0%)
zf-C2H2 221..243 CDD:278523 7/21 (33%)
C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
zf-H2C2_2 235..258 CDD:290200 6/26 (23%)
C2H2 Zn finger 251..269 CDD:275368 9/17 (53%)
C2H2 Zn finger 436..456 CDD:275368 9/19 (47%)
zf-H2C2_2 449..471 CDD:290200 9/22 (41%)
zf-C2H2 462..484 CDD:278523 6/22 (27%)
C2H2 Zn finger 464..484 CDD:275368 6/20 (30%)
C2H2 Zn finger 492..512 CDD:275368 7/19 (37%)
zf-H2C2_2 504..529 CDD:290200 6/24 (25%)
C2H2 Zn finger 520..540 CDD:275368 6/19 (32%)
C2H2 Zn finger 548..568 CDD:275368
zf-H2C2_2 560..584 CDD:290200
C2H2 Zn finger 576..595 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.