Sequence 1: | NP_650060.1 | Gene: | CG31388 / 41355 | FlyBaseID: | FBgn0051388 | Length: | 446 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001171975.1 | Gene: | E4f1 / 681359 | RGDID: | 1596731 | Length: | 783 | Species: | Rattus norvegicus |
Alignment Length: | 392 | Identity: | 85/392 - (21%) |
---|---|---|---|
Similarity: | 129/392 - (32%) | Gaps: | 146/392 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 167 SNEHFDMGLSPESE-PESEAIDNRD-----------------------TSSS---HTCSKCGLEF 204
Fly 205 ENVDEL-KLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRH------CN---------------- 246
Fly 247 ----------------------MINLPLTHSCTKCKSQFHNHILLETHKQR-------------- 275
Fly 276 -------CLRPPASQHVCH------------ICGKH------------------------LTTAF 297
Fly 298 NLKNHLVRHAGT--RRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHE 360
Fly 361 RVHMDASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAK----HYRSHLKSN 421
Fly 422 AH 423 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31388 | NP_650060.1 | zf-AD | 4..76 | CDD:285071 | |
C2H2 Zn finger | 228..254 | CDD:275368 | 12/69 (17%) | ||
C2H2 Zn finger | 286..306 | CDD:275368 | 3/55 (5%) | ||
C2H2 Zn finger | 314..334 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 342..363 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 373..393 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 401..419 | CDD:275368 | 7/21 (33%) | ||
E4f1 | NP_001171975.1 | COG5048 | 193..594 | CDD:227381 | 78/365 (21%) |
C2H2 Zn finger | 195..215 | CDD:275368 | 0/19 (0%) | ||
zf-C2H2 | 221..243 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 223..243 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 235..258 | CDD:290200 | 6/26 (23%) | ||
C2H2 Zn finger | 251..269 | CDD:275368 | 9/17 (53%) | ||
C2H2 Zn finger | 436..456 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 449..471 | CDD:290200 | 9/22 (41%) | ||
zf-C2H2 | 462..484 | CDD:278523 | 6/22 (27%) | ||
C2H2 Zn finger | 464..484 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 492..512 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 504..529 | CDD:290200 | 6/24 (25%) | ||
C2H2 Zn finger | 520..540 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 548..568 | CDD:275368 | |||
zf-H2C2_2 | 560..584 | CDD:290200 | |||
C2H2 Zn finger | 576..595 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |