DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31388 and Zfp524

DIOPT Version :9

Sequence 1:	NP_650060.1	Gene:	CG31388 / 41355	FlyBaseID:	FBgn0051388	Length:	446	Species:	Drosophila melanogaster
Sequence 2:	NP_079600.1	Gene:	Zfp524 / 66056	MGIID:	1916740	Length:	321	Species:	Mus musculus

Alignment Length:	137	Identity:	43/137 - (31%)
Similarity:	66/137 - (48%)	Gaps:	10/137 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   307 AGTRR--HKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVH--MDAS 367
            :|::|  |.|..|..:|...::|..|..:|:..:|::|: :|||||:    ||.|.|.|  :.|.
Mouse   102 SGSKRAPHFCPVCLRAFPYLSDLERHSISHSELKPHVCK-DCGKTFK----RSSHLRRHCNIHAG 161

  Fly   368 KRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTLEARAKA 432
            .|.::|..||:.:....|...|.:.|:..|.:.|..||:.|..|...|.|.| ..|..|......
Mouse   162 LRPFRCVLCPRRFREAGELAHHHRIHSGERPYQCPSCRVRFTEANTLRRHYK-RKHPELVGMPVR 225

  Fly   433 AASPNSR 439
            ...||.|
Mouse   226 LCPPNPR 232

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31388	NP_650060.1	zf-AD	4..76	CDD:285071
		C2H2 Zn finger	228..254	CDD:275368
		C2H2 Zn finger	286..306	CDD:275368
		C2H2 Zn finger	314..334	CDD:275368	5/19 (26%)
		C2H2 Zn finger	342..363	CDD:275368	10/20 (50%)
		C2H2 Zn finger	373..393	CDD:275368	5/19 (26%)
		C2H2 Zn finger	401..419	CDD:275368	7/17 (41%)
Zfp524	NP_079600.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..80
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	86..105		1/2 (50%)
		COG5048	<102..218	CDD:227381	39/121 (32%)
		C2H2 Zn finger	111..131	CDD:275368	5/19 (26%)
		C2H2 Zn finger	139..159	CDD:275368	11/24 (46%)
		C2H2 Zn finger	167..187	CDD:275368	5/19 (26%)
		C2H2 Zn finger	195..216	CDD:275368	8/21 (38%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	248..321
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100