DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and ZNF581

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_057619.1 Gene:ZNF581 / 51545 HGNCID:25017 Length:197 Species:Homo sapiens


Alignment Length:249 Identity:52/249 - (20%)
Similarity:79/249 - (31%) Gaps:98/249 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 SVASPQ-SSPE-----LSTDSQLSNEHFDMGLSPESEPESEAIDNRDTSSSHTCSKCGLEFENVD 208
            |:.||| |||.     |..|:|  ...:.:.:..||:.|..|.........::|..|...||.:.
Human    38 SIGSPQASSPPRPNHYLLIDTQ--GVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMS 100

  Fly   209 ELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTHSCTKCKSQFHNHILLETHK 273
            .|:.|.....::.|   |.||.|.:.|:.|:.|.||                             
Human   101 YLQRHSITHSEVKP---FECDICGKAFKRASHLARH----------------------------- 133

  Fly   274 QRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHTTER 338
                      |..|:.|                 |.|.|.|..|...|..|.||..|.:.|:.||
Human   134 ----------HSIHLAG-----------------GGRPHGCPLCPRRFRDAGELAQHSRVHSGER 171

  Fly   339 PYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQKY 392
            |                               :||.:||:.::..:..:.|.::
Human   172 P-------------------------------FQCPHCPRRFMEQNTLQKHTRW 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 8/25 (32%)
C2H2 Zn finger 286..306 CDD:275368 2/19 (11%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..363 CDD:275368 0/20 (0%)
C2H2 Zn finger 373..393 CDD:275368 4/20 (20%)
C2H2 Zn finger 401..419 CDD:275368
ZNF581NP_057619.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 7/13 (54%)
C2H2 Zn finger 89..109 CDD:275368 6/19 (32%)
zf-H2C2_2 101..126 CDD:404364 8/27 (30%)
C2H2 Zn finger 117..137 CDD:275368 9/58 (16%)
C2H2 Zn finger 147..167 CDD:275368 7/19 (37%)
C2H2 Zn finger 175..193 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.