DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and CG4936

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:512 Identity:108/512 - (21%)
Similarity:182/512 - (35%) Gaps:109/512 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICRTCSRMADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFRRVC 68
            :||.|.:.....:|....|.|...:...|.....:.:|:....|..:|:.|...|::|..||..|
  Fly    22 VCRVCLQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETC 86

  Fly    69 IEA-----QELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDF--------- 119
            ..:     |.:..:::.|...|::..|:..:...|..|||........:.::.:|.         
  Fly    87 QRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEAD 151

  Fly   120 --------IFDPEPQD-----KNTDELASIKTTTT------TEYMNAYQSVASPQSSPELSTDSQ 165
                    :|..|.:|     ...|.:..:|....      .|..:.|::...     :|..|..
  Fly   152 DAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEG-----DLIPDQG 211

  Fly   166 LSNEHFDMGLSPESEPESEAIDNRD----TSSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKF 226
            ..:|..|..|| |...|.|.:|..:    |.|:|         |:..|:.|:......:|..:..
  Fly   212 YDHEMADQALS-ELSAEIEYLDQVEHDQLTESAH---------EDDAEVDLNSTEEEFVPSKSVR 266

  Fly   227 VCDHCDEGFR-------------------SAAALTRHCNMIN----------------------- 249
            ...|.....:                   |.:..|...|.:.                       
  Fly   267 ASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISI 331

  Fly   250 ---LPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRR 311
               |...||..|.|.  .:.|||...|:       .:::|.:||....:...|..|:..|:|.:.
  Fly   332 GEVLARKHSGIKTKG--GHKILLGDKKE-------FKYICDVCGNMYPSQSRLTEHIKVHSGVKP 387

  Fly   312 HKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYC 376
            |:|:.|...|..|.:|..|..|||..|||.|.| |...|...|.|:.|.|:|  .::|.|:|:.|
  Fly   388 HECEICGHCFAQAQQLARHMNTHTGNRPYKCSY-CPAAFADLSTRNKHHRIH--TNERPYECDVC 449

  Fly   377 PKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTLEARAKAA 433
            .|::...:..:.|:..|...:.|.|::|...|..|...|:|...:..:...||...|
  Fly   450 HKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHERRGQSARESVA 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 17/76 (22%)
C2H2 Zn finger 228..254 CDD:275368 5/70 (7%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..363 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..393 CDD:275368 4/19 (21%)
C2H2 Zn finger 401..419 CDD:275368 6/17 (35%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 16/72 (22%)
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 8/23 (35%)
COG5048 386..>447 CDD:227381 24/63 (38%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 11/23 (48%)
C2H2 Zn finger 418..438 CDD:275368 8/20 (40%)
zf-H2C2_2 432..455 CDD:290200 8/24 (33%)
C2H2 Zn finger 446..466 CDD:275368 4/19 (21%)
zf-H2C2_2 459..481 CDD:290200 5/21 (24%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.