DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and trem

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster


Alignment Length:462 Identity:104/462 - (22%)
Similarity:175/462 - (37%) Gaps:108/462 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICRTCSRMADPAVAKNL----FDPSSSSVLRQ-IETLTNLQLKEDGKLPRFMCQDCQHDLQIAID 63
            :||.|  :.:|:..:.|    |..::|:.|.| :.....:.:..|...|..||..|...|::...
  Fly    11 VCRVC--LNNPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLDDNFPDKMCSKCVRCLRLCYK 73

  Fly    64 FRRVCIEA-QELLELQLRQVEK-------------EEEAFESLAEQWLDDCPDELSNLSPVLQLN 114
            ||..|..: |.::::..|:...             |:.:.||:.:.| :|...:|.....|....
  Fly    74 FRLTCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSW-EDYASQLDGGMKVEGEE 137

  Fly   115 DRMDFIFDPEPQDKNTDELASI--------------KTTTTTEYMNAYQSVASPQSSPEL----- 160
            |:...:.....:|.:||:....              :..|..|| ..|:.:.: ::|||:     
  Fly   138 DQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEY-EEYELLTN-ENSPEIAQEKG 200

  Fly   161 STDSQLSNEHFDMGLSPESEPESEAIDNRDTSSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTK 225
            ||.:.::.|.     .||.|...:.:|:                   ||         |..| |.
  Fly   201 STGTDVATEE-----PPEEEIAEDILDS-------------------DE---------DYDP-TH 231

  Fly   226 FVCDHCDEGFRSAAALTRHCNMINLPLTHSCTKCKSQFH-NHILLETHKQRCLRPP---ASQHVC 286
            ...:.||...|...|                      :| |...:||.|::..|.|   .|.::|
  Fly   232 AKPEKCDRSGRKPVA----------------------YHKNSPKVETFKKKVGRKPRNKLSTYIC 274

  Fly   287 HICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFR 351
            .:||....|...|..|:..|:|.:.|:|:.|...|....:|..|..|||..|||.|.| |...|.
  Fly   275 DVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNY-CPAAFA 338

  Fly   352 FCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRS 416
            ..|.::.|.|:|  ..:|.|.|:.|.:::......:.|:..|...:.|.|::|...|  .|.|:.
  Fly   339 DRSTKTKHHRIH--TKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGF--VKAYKL 399

  Fly   417 HLKSNAH 423
            .|....|
  Fly   400 RLHRETH 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 19/77 (25%)
C2H2 Zn finger 228..254 CDD:275368 4/25 (16%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..363 CDD:275368 7/20 (35%)
C2H2 Zn finger 373..393 CDD:275368 3/19 (16%)
C2H2 Zn finger 401..419 CDD:275368 5/17 (29%)
tremNP_650861.1 zf-AD 11..87 CDD:214871 19/77 (25%)
COG5048 <264..411 CDD:227381 44/148 (30%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 8/23 (35%)
C2H2 Zn finger 302..322 CDD:275368 5/19 (26%)
zf-H2C2_2 315..338 CDD:290200 11/23 (48%)
C2H2 Zn finger 330..350 CDD:275368 7/20 (35%)
zf-H2C2_2 345..367 CDD:290200 7/23 (30%)
C2H2 Zn finger 358..378 CDD:275368 3/19 (16%)
zf-H2C2_2 370..394 CDD:290200 6/25 (24%)
C2H2 Zn finger 386..406 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26194
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.