DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and CG17806

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:476 Identity:118/476 - (24%)
Similarity:174/476 - (36%) Gaps:112/476 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYICRTCSRMADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFR 65
            |..:||||.:.|:.  ||:|||..:..||..|..||...|:....:|..:|..|..||..||.||
  Fly     1 MTTLCRTCGQEAEH--AKSLFDKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFR 63

  Fly    66 RVCIEAQELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDF----IFDPE-- 124
            ..||..             ....||...:|  :|...|.:......:|..|:|.    |..|:  
  Fly    64 ERCIRT-------------NSSWFEKQGKQ--EDSDTETAREGGNNRLESRVDVMPISIAQPQRR 113

  Fly   125 ---PQDKNTDELASIKTTTTTEYMNAYQSV-----ASP---------QSSPELSTDSQLSNEHFD 172
               ||.....:...:||..|..|......:     ..|         :|.|:||:|..:.:.:.:
  Fly   114 RILPQRSKKVDGVPLKTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHE 178

  Fly   173 MGLSP-----ESEPES-----EAIDNRDTSSSHTC-----SKCGLEFENVD----ELKLHKYHLH 218
            ...|.     :.||.:     |...||....|..|     .|...:.||:|    :.|..||...
  Fly   179 EPASEMPQVMKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATR 243

  Fly   219 DIPPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQ 283
            :                :..||...:.      |.|..                           
  Fly   244 N----------------KWGAAKRAYA------LEHRL--------------------------- 259

  Fly   284 HVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQK-THTTERPYICRYNCG 347
            :.|..|||..:...|...||.||.||:..:|.:|....:|...|..|.: .|..|.||:|:| ||
  Fly   260 YFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKY-CG 323

  Fly   348 KTFRFCSARSMHERVHMDAS-KRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTA 411
            |.|..|..|..|||.|.::. .|.:.|..|.|::.|.:..:.|...|...:...||:|:..|...
  Fly   324 KRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRR 388

  Fly   412 KHYRSHLKSNAHK-TLEARAK 431
            ....:|.||..|: .:|.::|
  Fly   389 NALATHYKSKHHRLKVEEQSK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 27/71 (38%)
C2H2 Zn finger 228..254 CDD:275368 3/25 (12%)
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 5/20 (25%)
C2H2 Zn finger 342..363 CDD:275368 11/20 (55%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 5/17 (29%)
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 28/86 (33%)
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
COG5048 <298..>383 CDD:227381 29/85 (34%)
C2H2 Zn finger 319..339 CDD:275368 11/20 (55%)
C2H2 Zn finger 350..370 CDD:275368 5/19 (26%)
ZnF_U1 375..407 CDD:197732 9/31 (29%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.