DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and su(Hw)

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster


Alignment Length:371 Identity:89/371 - (23%)
Similarity:126/371 - (33%) Gaps:133/371 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DMGLSPESEPESEAIDNRDTSS--------SHTCSKCGLEFENVDELKLH--------KYHLHD- 219
            |..|..:.:.:.|....:..||        .|.|.||...|..|..||.|        .|||.. 
  Fly   189 DEDLGEDGDEDGEDSSGKGNSSQTKIKEIVEHVCGKCYKTFRRVQSLKKHLEFCRYDSGYHLRKA 253

  Fly   220 -------------IPPDTKFVCDHCDEGFRSAAALTRHCNMINLP-----------------LTH 254
                         :..:.|.:|..|.|.:.     |.|...||.|                 :||
  Fly   254 DMLKNLEKIEKDAVVMEKKDICFCCSESYD-----TFHLGHINCPDCPKSFKTQTSYERHIFITH 313

  Fly   255 S------CTKCKSQFHNHILL----ETHKQRCLRPPASQHVCHICGKHLTTAF------------ 297
            |      |:.|.:...:..||    |.||.|     ...:.|.||||..|.::            
  Fly   314 SEFSDFPCSICNANLRSEALLALHEEQHKSR-----GKPYACKICGKDFTRSYHLKRHQKYSSCS 373

  Fly   298 --------------------NLKNHLVRHAGTR-----RHKCDQCSASFYTAAELCSHQKTHTTE 337
                                ||::||.:|.||:     .:.|..|...||:.:.|..|.:|||.|
  Fly   374 SNETDTMSCKVCDRVFYRLDNLRSHLKQHLGTQVVKKPEYMCHTCKNCFYSLSTLNIHIRTHTGE 438

  Fly   338 RPYICRYNCGKTFRFCSARSMHERVH--------------------------MDASKRIYQCEYC 376
            :|:.|.. |.|.|....|...|.|.|                          ....:|.::|:.|
  Fly   439 KPFDCDL-CDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHMKRHTGERPHKCDEC 502

  Fly   377 PKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNA 422
            .||::..::.|||.|.|  .|...||.|...|||.|....|:|:::
  Fly   503 GKSFIQATQLRTHSKTH--IRPFPCEQCDEKFKTEKQLERHVKTHS 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 8/42 (19%)
C2H2 Zn finger 286..306 CDD:275368 10/51 (20%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..363 CDD:275368 7/20 (35%)
C2H2 Zn finger 373..393 CDD:275368 8/19 (42%)
C2H2 Zn finger 401..419 CDD:275368 8/17 (47%)
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368 1/20 (5%)
COG5048 <312..517 CDD:227381 51/210 (24%)
C2H2 Zn finger 321..341 CDD:275368 5/19 (26%)
zf-C2H2 348..368 CDD:278523 6/19 (32%)
C2H2 Zn finger 350..368 CDD:275368 6/17 (35%)
C2H2 Zn finger 382..402 CDD:275368 4/19 (21%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-H2C2_2 428..451 CDD:290200 10/23 (43%)
C2H2 Zn finger 443..463 CDD:275368 7/20 (35%)
zf-H2C2_2 455..479 CDD:290200 4/23 (17%)
COG5048 <467..620 CDD:227381 20/82 (24%)
C2H2 Zn finger 471..491 CDD:275368 0/19 (0%)
zf-H2C2_2 484..508 CDD:290200 5/23 (22%)
C2H2 Zn finger 499..519 CDD:275368 8/19 (42%)
C2H2 Zn finger 525..545 CDD:275368 9/19 (47%)
C2H2 Zn finger 555..572 CDD:275368
C2H2 Zn finger 598..615 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.