| Sequence 1: | NP_650060.1 | Gene: | CG31388 / 41355 | FlyBaseID: | FBgn0051388 | Length: | 446 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001036004.1 | Gene: | MAZ / 4150 | HGNCID: | 6914 | Length: | 493 | Species: | Homo sapiens |
| Alignment Length: | 397 | Identity: | 86/397 - (21%) |
|---|---|---|---|
| Similarity: | 138/397 - (34%) | Gaps: | 136/397 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 123 PEPQDKNTDELASIKTTTTTEYMNAYQSVASPQSSPELS----------TDSQLSNEHFDMGLSP 177
Fly 178 ES----EPESEAIDNRDTSSS-HTCSKCGLEFENVDELKLHK----------------------- 214
Fly 215 YHLHDIPP-----------------------------------DTKFVCDHCDEGFRSAAALTRH 244
Fly 245 CNMINLPLTHS------CTKCKSQFHN------HILLETHKQRCLRPPASQHVCHICGKHLTTAF 297
Fly 298 NLKNHLVR-HAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSAR-SMHE 360
Fly 361 RVHMDASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHG----------CEICRISFKT----A 411
Fly 412 KHYRSHL 418 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31388 | NP_650060.1 | zf-AD | 4..76 | CDD:285071 | |
| C2H2 Zn finger | 228..254 | CDD:275368 | 8/25 (32%) | ||
| C2H2 Zn finger | 286..306 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 314..334 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 342..363 | CDD:275368 | 8/21 (38%) | ||
| C2H2 Zn finger | 373..393 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 401..419 | CDD:275368 | 8/22 (36%) | ||
| MAZ | NP_001036004.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 59..78 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 121..146 | 8/35 (23%) | |||
| C2H2 Zn finger | 192..212 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 281..301 | CDD:275368 | 8/25 (32%) | ||
| SFP1 | <303..360 | CDD:227516 | 12/62 (19%) | ||
| C2H2 Zn finger | 309..329 | CDD:275368 | 4/21 (19%) | ||
| C2H2 Zn finger | 339..357 | CDD:275368 | 6/17 (35%) | ||
| C2H2 Zn finger | 368..388 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 394..413 | CDD:275368 | 8/21 (38%) | ||
| C2H2 Zn finger | 421..437 | CDD:275368 | 6/15 (40%) | ||
| C2H2 Zn finger | 454..474 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24390 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||