DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and ouib

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:423 Identity:101/423 - (23%)
Similarity:159/423 - (37%) Gaps:121/423 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYICRTCSRMADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFR 65
            :..:||.|.|......:.||||..:...|:.:..::.|:|.:...:|.|||..||.:|:.|:.||
  Fly     2 LNIVCRVCGRQKICEKSLNLFDLVNRKYLKHLHMISGLRLVDLDDVPGFMCLCCQAELRSALAFR 66

  Fly    66 RVCIEAQELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQDKNT 130
            ::||:.|                     .:||....|..|.               |.:..|.: 
  Fly    67 KLCIKTQ---------------------TKWLTIEDDSSSG---------------DEDTNDNS- 94

  Fly   131 DELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPESEAIDNRDTSSSH 195
             ||.|.|.        |:......:       :.:|..|.|.:.:  |.||..:.: |||     
  Fly    95 -ELESEKC--------AFSDFGKKK-------EGELVEETFQVLI--EEEPMDKTL-NRD----- 135

  Fly   196 TCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTHSCTKCK 260
              :|..|..:.:||         ...|..|.:                              |..
  Fly   136 --AKAQLREDGIDE---------KCVPSQKII------------------------------KVS 159

  Fly   261 SQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAA 325
            ::..:.|                ::|.:||.|.|:....:.|:.:|.|.|...|..|.|.|.:|.
  Fly   160 TKLDDQI----------------YICELCGTHATSKPTFQRHMRKHRGERPFGCKDCDARFLSAG 208

  Fly   326 ELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQ 390
            ||.:|.:.||.|:|:.||: |.|.:.....|.:|||.|  .:.|.|.||.|.|.:.|....:.|.
  Fly   209 ELRAHHRVHTGEQPFACRF-CEKRYVSYMGRLIHERTH--TNDRPYVCEECGKKFTTAYVLKNHM 270

  Fly   391 KYHNLTRDHGCEICRISFKTAKHYRSHLKSNAH 423
            ..|...|:..|:||..||:...|..:|.:|..|
  Fly   271 VIHTGERNFRCDICDRSFQRKAHLVTHTRSMMH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 24/71 (34%)
C2H2 Zn finger 228..254 CDD:275368 0/25 (0%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 8/19 (42%)
C2H2 Zn finger 342..363 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..393 CDD:275368 6/19 (32%)
C2H2 Zn finger 401..419 CDD:275368 7/17 (41%)
ouibNP_649822.2 zf-AD 5..78 CDD:214871 25/93 (27%)
COG5048 <158..300 CDD:227381 48/160 (30%)
C2H2 Zn finger 169..189 CDD:275368 6/19 (32%)
C2H2 Zn finger 197..217 CDD:275368 8/19 (42%)
zf-H2C2_2 209..234 CDD:290200 11/25 (44%)
C2H2 Zn finger 225..245 CDD:275368 8/20 (40%)
zf-H2C2_2 241..262 CDD:290200 10/22 (45%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 266..288 CDD:290200 6/21 (29%)
C2H2 Zn finger 281..299 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.