DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and CG17359

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:423 Identity:101/423 - (23%)
Similarity:156/423 - (36%) Gaps:106/423 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICRTCSRMAD--------PAVAKNLF---DPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHD 57
            :||.|...:|        |..:.|..   :|..:::||:....:  ..|||| :|:|:|.:|...
  Fly     6 MCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCS--VHKEDG-MPQFICVECAEA 67

  Fly    58 LQIAIDFRRVCIEAQELLELQLRQVEKEEEAFESLAEQWLDD---CPDELSNLSPVLQLNDRMDF 119
            ::.|...||.|.::.:..| |||.:.||           |||   |.:...|:.|.:.:: .|:.
  Fly    68 VRNAYRLRRQCRKSHQYFE-QLRLMMKE-----------LDDIEYCLNIGDNIEPQMPVS-VMEA 119

  Fly   120 IFDPEPQDKNTDELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEH-FDMGLSPESEPES 183
            ...||..:....||..:|      ||       .|:..| :|:....:||| .....||...|.:
  Fly   120 GKTPETSEPLLVELVQVK------YM-------PPEPKP-ISSPLPDNNEHKLAQSYSPAKTPHN 170

  Fly   184 EAIDNRDTSSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMI 248
            ::.....:.|.:.......|.|:.|:.|:........|.                          
  Fly   171 KSKRRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPK-------------------------- 209

  Fly   249 NLPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHK 313
            .:|..:.|..|...|       |.||                       ||:.|:..|.|.|.:|
  Fly   210 RVPGPYRCKLCTQSF-------TQKQ-----------------------NLEIHMRIHTGERPYK 244

  Fly   314 CDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPK 378
            |..|..||.....|.||.:.||.|||:.|. ||.|.||......:|.|.|  ..::.::|..|.:
  Fly   245 CSLCPRSFAQKGNLQSHTRCHTGERPFGCP-NCPKRFRQVGQLQVHTRTH--TGEQPFKCSKCQQ 306

  Fly   379 SYVTPSECRTHQKYH--NLTRDHGCEICRISFK 409
            |:...:..:.|...|  ...|....|..|..||
  Fly   307 SFKQLNGLQKHMSAHTRGKRRTSSQETKRNKFK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 21/82 (26%)
C2H2 Zn finger 228..254 CDD:275368 1/25 (4%)
C2H2 Zn finger 286..306 CDD:275368 3/19 (16%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..363 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..393 CDD:275368 4/19 (21%)
C2H2 Zn finger 401..419 CDD:275368 4/9 (44%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 22/85 (26%)
zf-C2H2 215..237 CDD:278523 9/51 (18%)
C2H2 Zn finger 217..237 CDD:275368 9/49 (18%)
zf-H2C2_2 229..254 CDD:290200 11/24 (46%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 13/25 (52%)
C2H2 Zn finger 273..293 CDD:275368 8/20 (40%)
zf-H2C2_2 286..310 CDD:290200 6/25 (24%)
C2H2 Zn finger 301..321 CDD:275368 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.