DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and pita

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster


Alignment Length:515 Identity:108/515 - (20%)
Similarity:196/515 - (38%) Gaps:110/515 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICRTCSRMADPAVAKNLFD-----PSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAID 63
            :||.|  :.:..:| ::|:     .:::::..||..:|.:::.....:|..:|.:|:...:....
  Fly    17 VCRFC--LTEQKLA-SIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYR 78

  Fly    64 FRRVCIEAQELLELQLRQ----------VEKEEEAFESLAEQWL----------DDCPDELSNL- 107
            |:::|..|:.|    |||          :||.......:|.:.|          .:.|.:|.|. 
  Fly    79 FKQMCKRAETL----LRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTM 139

  Fly   108 ----------------------------SPVLQLNDRMDFIFDPEPQDKNTDELASIKTTTTTEY 144
                                        |||.:.:...:...| ..|:.:.|::.|:.....:|.
  Fly   140 AKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVD-NNQELSMDDVQSMLEDMASEL 203

  Fly   145 MNAYQSV---ASP-------QSS-------------PELSTDSQLSNEHFDMGLSPESEPESEAI 186
            ...:..:   |||       :||             |.|:|.....::..::.:..|.......:
  Fly   204 EKEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDLPL 268

  Fly   187 DNRDTSSSHT---------CSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALT 242
            |::|..:.:.         |..|...|.....|::|:.: |  .....|.|..|::.|.|...|.
  Fly   269 DDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLN-H--TRSRSFQCLLCEKSFFSKYDLA 330

  Fly   243 RHCNMINL---PLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLV 304
            :| |.::.   |.  .|..|...|....||..|::.....|  :.:|..|.|...:...::.|..
  Fly   331 KH-NFVHTGERPF--KCAICSKAFTRKALLHRHERTHTDVP--KFICVYCEKPFLSRQEMEKHAE 390

  Fly   305 RHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKR 369
            ||...|..:|..|:.||.....|..|:..|:|..|:.|:: |.::|...|..:.|...|  |.||
  Fly   391 RHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQH-CERSFSTASKLARHLVAH--AGKR 452

  Fly   370 IYQCEYCPKSYVTPSECRTHQKYHNLTRDHG--CEICRISFKTAKHYRSHLKSNAHKTLE 427
            .|.|:||.|||:.......|.:.|..|.|..  |..|::|:........|...:|..:|:
  Fly   453 AYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHALIHATASLK 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 15/76 (20%)
C2H2 Zn finger 228..254 CDD:275368 8/28 (29%)
C2H2 Zn finger 286..306 CDD:275368 4/19 (21%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..363 CDD:275368 5/20 (25%)
C2H2 Zn finger 373..393 CDD:275368 7/19 (37%)
C2H2 Zn finger 401..419 CDD:275368 4/17 (24%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871 16/81 (20%)
COG5048 <281..506 CDD:227381 62/235 (26%)
C2H2 Zn finger 288..308 CDD:275368 5/20 (25%)
C2H2 Zn finger 316..336 CDD:275368 7/20 (35%)
zf-H2C2_2 328..353 CDD:290200 7/27 (26%)
C2H2 Zn finger 344..364 CDD:275368 6/19 (32%)
C2H2 Zn finger 372..388 CDD:275370 3/15 (20%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 428..448 CDD:275368 5/20 (25%)
C2H2 Zn finger 456..476 CDD:275368 7/19 (37%)
C2H2 Zn finger 486..506 CDD:275368 4/19 (21%)
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.