DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and Zfp524

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001102375.1 Gene:Zfp524 / 365179 RGDID:1565485 Length:314 Species:Rattus norvegicus


Alignment Length:137 Identity:43/137 - (31%)
Similarity:66/137 - (48%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 AGTRR--HKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVH--MDAS 367
            :|::|  |.|..|..:|...::|..|..:|:..:|::|: :|||||:    ||.|.|.|  :.|.
  Rat   102 SGSKRAPHFCPVCLRAFPYLSDLERHSISHSELKPHVCK-DCGKTFK----RSSHLRRHCNIHAG 161

  Fly   368 KRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTLEARAKA 432
            .|.::|..||:.:....|...|.:.|:..|.:.|..||:.|..|...|.|.| ..|..|......
  Rat   162 LRPFRCVLCPRRFREAGELAHHHRIHSGERPYQCPSCRVRFTEANTLRRHYK-RKHPELVGMPVR 225

  Fly   433 AASPNSR 439
            ...||.|
  Rat   226 LCPPNPR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368
C2H2 Zn finger 286..306 CDD:275368
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..363 CDD:275368 10/20 (50%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 7/17 (41%)
Zfp524NP_001102375.1 COG5048 <102..218 CDD:227381 39/121 (32%)
C2H2 Zn finger 111..131 CDD:275368 5/19 (26%)
zf-H2C2_2 123..148 CDD:290200 10/29 (34%)
C2H2 Zn finger 139..159 CDD:275368 11/24 (46%)
zf-H2C2_2 151..174 CDD:290200 8/22 (36%)
C2H2 Zn finger 167..187 CDD:275368 5/19 (26%)
zf-H2C2_2 179..203 CDD:290200 7/23 (30%)
C2H2 Zn finger 195..216 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.