DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and CG12391

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster


Alignment Length:442 Identity:90/442 - (20%)
Similarity:138/442 - (31%) Gaps:125/442 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTCSRMAD-PAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFRRVC 68
            ||.|:...: ..:.|...|.:.:.:|..|  ..|:.:.....:|:|:|..|...|.|||..|:..
  Fly   241 CRVCTSKEELVCLFKKQIDATPADMLLVI--CPNVSILPKDFMPQFICTKCMGSLTIAIQLRKQL 303

  Fly    69 IEAQELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQDKNTDEL 133
            ....:  ||:.|....:.:.........:|         :||..         ..|.:|:..||.
  Fly   304 ETTDQ--ELRKRLSRSKNKVRRPRGYVVID---------APVTD---------SSEDEDELDDEF 348

  Fly   134 ASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPESEAIDNRDTSSSHTCS 198
            .......||          |..|....|.||:...:.......|..:|.....|:....||    
  Fly   349 KVSDVAGTT----------SADSDSADSDDSEKEKKKPGPRGRPRKKPLKRGTDSDGEPSS---- 399

  Fly   199 KCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTHSCTKCKSQF 263
                       .:..||..........|.|.:||..|....:...|                   
  Fly   400 -----------AQKKKYQPSSTASVGPFECPNCDLTFSRKQSYVLH------------------- 434

  Fly   264 HNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRH-KCDQCSASFYTAAEL 327
                 .:||::       .:|.|.||||.....:..|.|:.||...|.| :|:.|...|...|||
  Fly   435 -----RKTHER-------IEHACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAEL 487

  Fly   328 CSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQKY 392
                |.|..:|                        | |....||:|:.|.::::|....:.||..
  Fly   488 ----KHHMAQR------------------------H-DEHGFIYECKRCQRTFLTQQRLQRHQAV 523

  Fly   393 HNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTLEARAKAAASPNSRGRNCS 444
                   ||:..:......|..:|..|.      |:|:|   .....|.|.|
  Fly   524 -------GCQRHKEDSVRIKEEQSRFKQ------ESRSK---DDRHHGNNSS 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 17/71 (24%)
C2H2 Zn finger 228..254 CDD:275368 5/25 (20%)
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..363 CDD:275368 0/20 (0%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 3/17 (18%)
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 19/75 (25%)
zf-C2H2 416..438 CDD:278523 6/45 (13%)
C2H2 Zn finger 418..438 CDD:275368 5/43 (12%)
zf-C2H2 443..465 CDD:278523 8/21 (38%)
C2H2 Zn finger 445..465 CDD:275368 7/19 (37%)
C2H2 Zn finger 474..491 CDD:275368 7/20 (35%)
C2H2 Zn finger 504..521 CDD:275368 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.